.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pfj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title TFIIH contains a PH domain involved in DNA nucleotide excision repair. Nat.Struct.Mol.Biol. 11 616-622 2004
    Site SPINE
    PDB Id 1pfj Target Id IGBMC-0024-000
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23880,P32780 Molecular Weight 62028.39 Da.
    Residues 548 Isoelectric Point 8.80
    Sequence matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegkakiqlqlvl hagdttnfhfsnestavkerdavkdllqqllpkfkrkankeleeknrmlqedpvlfqlykdlvvsqvis aeefwanrlnvnatdssstsnhkqdvgisaafladvrpqtdgcnglrynltsdiiesifrtypavkmky aenvphnmtekefwtrffqshyfhrdrlntgskdlfaecakidekglktmvslgvknplldltaledkp ldegygissvpsasnsksikensnaaiikrfnhhsamvlaaglrkqeaqneqtsepsnmdgnsgdadcf qpavkraklqesieyedlgknnsvktialnlkksdryyhgptpiqslqyatsqdiinsfqsirqemeay tpkltqvlsssaasstitalspggalmqggtqqainqmvpndiqselkhlyvavgellrhfwscfpvnt pfleekvvkmksnlerfqvtklcpfqekirrqylstnlvshieemlqtaynklhtwqsrrlmkkt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch