.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q0r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism. J.Biol.Chem. 278 39006-39013 2003
    Site SPINE
    PDB Id 1q0r Target Id St_1
    Related PDB Ids 1q0z 
    Molecular Characteristics
    Source Streptomyces purpurascens
    Alias Ids TPS23838,AAA83422 Molecular Weight 31790.08 Da.
    Residues 298 Isoelectric Point 5.06
    Sequence mserivpsgdvelwsddfgdpadpalllvmggnlsalgwpdefarrladgglhvirydhrdtgrsttrd faahpygfgelaadavavldgwgvdrahvvglsmgatitqvialdhhdrlssltmllgggldidfdani ervmrgeptldglpgpqqpfldalalmnqpaegraaevakrvskwrilsgtgvpfddaeyarweeraid haggvlaepyahysltlpppsraaelrevtvptlviqaehdpiapaphgkhlagliptarlaeipgmgh alpssvhgplaevilahtrsaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.187
    Matthews' coefficent 2.22 Rfactor 0.163
    Waters 256 Solvent Content 44.49

    Ligand Information
    Ligands AKT (10-DECARBOXYMETHYLACLACINOMYCIN) x 1;SO4 (SULFATE) x 1;1PE (PENTAETHYLENE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch