.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s6u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure and Backbone Dynamics of the Cu(I) and Apo Forms of the Second Metal-Binding Domain of the Menkes Protein ATP7A. Biochemistry 43 3396-3403 2004
    Site SPINE
    PDB Id 1s6u Target Id CIRMMP25
    Related PDB Ids 1s6o 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23946,NP_000043 Molecular Weight 8446.58 Da.
    Residues 76 Isoelectric Point 8.66
    Sequence gevvlkmkvegmtchsctstiegkigklqgvqrikvsldnqeativyqphlisveemkkqieamgfpaf vkkiegr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals CU1 (COPPER) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch