The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding. J.Biol.Chem. 280 9578-9585 2005
    Site SPINE
    PDB Id 1su3 Target Id MPIB-401
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23907,P03956 Molecular Weight 54004.27 Da.
    Residues 469 Isoelectric Point 6.47
    Sequence mhsfpplllllfwgvvshsfpatletqeqdvdlvqkylekyynlkndgrqvekrrnsgpvveklkqmqe ffglkvtgkpdaetlkvmkqprcgvpdvaqfvltegnprweqthltyrienytpdlpradvdhaiekaf qlwsnvtpltftkvsegqadimisfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnf reynlhrvaahelghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpigpqtpk acdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaayefadrdevrffkg nkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyffvankywrydeykrsmdpgypkm iahdfpgighkvdavfmkdgffyffhgtrqykfdpktkriltlqkanswfncrkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.25233
    Matthews' coefficent 3.62 Rfactor 0.22269
    Waters 372 Solvent Content 66.04

    Ligand Information
    Ligands SO4 (SULFATE) x 5;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals CA (CALCIUM) x 8;CL (CHLORIDE) x 2;NA (SODIUM) x 2;ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch