The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Experimentally exploring the conformational space sampled by domain reorientation in calmodulin. Proc.Natl.Acad.Sci.USA 101 6841-6846 2004
    Site SPINE
    PDB Id 1sw8 Target Id CIRMMP35
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23964, Molecular Weight 8793.28 Da.
    Residues 79 Isoelectric Point 4.02
    Sequence adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgdgtidfpefl tmmarkmkdt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals CA (CALCIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch