The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of tRNA pseudouridine synthase TruD reveals an inserted domain with a novel fold. Febs Lett. 565 59-64 2004
    Site SPINE
    PDB Id 1szw Target Id AF46
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS23829,Q57261 Molecular Weight 39089.44 Da.
    Residues 349 Isoelectric Point 6.15
    Sequence miefdnltylhgkpqgtgllkanpedfvvvedlgfepdgegehilvrilkngcntrfvadalakflkih arevsfagqkdkhavteqwlcarvpgkempdlsafqlegcqvleyarhkrklrlgalkgnaftlvlrev snrddveqrlidicvkgvpnyfgaqrfgiggsnlqgaqrwaqtntpvrdrnkrsfwlsaarsalfnqiv aerlkkadvnqvvdgdalqlagrgswfvatteelaelqrrvndkelmitaalpgsgewgtqrealafeq aavaaetelqallvrekveaarramllypqqlswnwwddvtveirfwlpagsfatsvvrelinttgdyahiae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23913
    Matthews' coefficent 2.30 Rfactor 0.19246
    Waters 475 Solvent Content 45.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch