The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the motor domain of the human kinetochore protein CENP-E. J.Mol.Biol. 340 1107-1116 2004
    Site SPINE
    PDB Id 1t5c Target Id CENP-E_342
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23868,Q02224 Molecular Weight 39376.55 Da.
    Residues 350 Isoelectric Point 6.95
    Sequence aeegavavcvrvrplnsreeslgetaqvywktdnnviyqvdgsksfnfdrvfhgnettknvyeeiaapi idsaiqgyngtifaygqtasgktytmmgsedhlgvipraihdifqkikkfpdrefllrvsymeiyneti tdllcgtqkmkpliiredvnrnvyvadlteevvytsemalkwitkgeksrhygetkmnqrssrshtifr milesrekgepsncegsvkvshlnlvdlagseraaqtgaagvrlkegcninrslfilgqvikklsdgqv ggfinyrdskltrilqnslggnpktriictitpvsfdetltalqfastakymkntpyvnevstdealeh hhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2782
    Matthews' coefficent 2.25 Rfactor 0.2277
    Waters 84 Solvent Content 40.00

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch