The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Human beta-Parvalbumin and Structural Comparison with Its Paralog alpha-Parvalbumin and with Their Rat Orthologs(,). Biochemistry 43 16076-16085 2004
    Site SPINE
    PDB Id 1ttx Target Id CIRMMP08
    Molecular Characteristics
    Source Homo sapiens (human)
    Alias Ids TPS23936,P32930 Molecular Weight 12026.55 Da.
    Residues 108 Isoelectric Point 4.14
    Sequence msitdvlsaddiaaalqecqdpdtfepqkffqtsglskmsanqvkdvfrfidndqsgyldeelkfflqk fesgareltesetkslmaaadndgdgkigaeefqemvhs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals CA (CALCIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch