The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products. J.Biol.Chem. 279 41149-41156 2004
    Site SPINE
    PDB Id 1tw2 Target Id ST_04
    Molecular Characteristics
    Source Streptomyces peuceticus
    Alias Ids TPS23846,Q06528 Molecular Weight 38779.84 Da.
    Residues 356 Isoelectric Point 5.12
    Sequence mtaeptvaarpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrli rhlvaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtgrptyesiy gkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsat vlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealep ggriliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpsptipydls llvlapaatga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.27052
    Matthews' coefficent 2.60 Rfactor 0.20296
    Waters 165 Solvent Content 54.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch