.
The Open Protein Structure Annotation Network
PDB Keyword
.

1txe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the active-centre mutant I14A of the histidine-containing phosphocarrier protein from Staphylococcus carnosus. Eur.J.Biochem. 271 4815-4824 2004
    Site SPINE
    PDB Id 1txe Target Id REGEN_HPr_Sc
    Molecular Characteristics
    Source Staphylococcus carnosus
    Alias Ids TPS23861, Molecular Weight 9468.09 Da.
    Residues 88 Isoelectric Point 4.38
    Sequence meqqsytiidetgaharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdaeitiyadgsd eadaiqaitdvlskeglte
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch