.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uos

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Snake-Venom Toxin Convulxin. Acta Crystallogr.,Sect.D 60 46-53 2004
    Site SPINE
    PDB Id 1uos Target Id OX_CVX
    Molecular Characteristics
    Source Crotalus durissus terrificus
    Alias Ids TPS14926,38493075 Molecular Weight 30721.15 Da.
    Residues 261 Isoelectric Point 6.07
    Sequence glhcpsdwyyydqhcyrifneemnwedaewfctkqakgahlvsiksakeadfvawmvtqnieesfshvs iglrvqnkekqcstkwsdgssvsydnlldlyitkcsllkketgfrkwfvascigkipfvckfppqcagf ccpshwssydrycykvfkqemtwadaekfctqqhtgshlvsfhsteevdfvvkmthqslkstffwigan niwnkcnwqwsdgtkpeykewheefeclisrtfdnqwlsapcsdtysfvckfea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.263
    Matthews' coefficent Rfactor 0.235
    Waters 320 Solvent Content 71

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch