.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uv2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Docking Approach to the Study of Copper Trafficking Proteins; Interaction between Metallochaperones and Soluble Domains of Copper Atpases. Structure 12 669 2004
    Site SPINE
    PDB Id 1uv2 Target Id CIRMMP33
    Related PDB Ids 1uv1 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS23959,NP_014140;NP_010556 Molecular Weight 16084.70 Da.
    Residues 145 Isoelectric Point 5.21
    Sequence maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekikktgkevrs gkqlarevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiiedcgfd ceilrds
      BLAST   FFAS

    Structure Determination
    Method Chains 1
    Resolution (Å) not Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals CU1 (COPPER) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch