The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Structure of Peptidyl-Prolyl Cis-Trans Isomerase a from Mycobacterium Tuberculosis. Eur.J.Biochem. 271 4107 2004
    Site SPINE
    PDB Id 1w74 Target Id rv0009
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS23972,P71578 Molecular Weight 19238.38 Da.
    Residues 182 Isoelectric Point 5.80
    Sequence madcdsvtnsplatatatlhtnrgdikialfgnhapktvanfvglaqgtkdystqnasggpsgpfydga vfhrviqgfmiqggdptgtgrggpgykfadefhpelqfdkpyllamanagpgtngsqffitvgktphln rrhtifgevidaesqrvveaisktatdgndrptdpvviesitis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.6 Rfree 0.229
    Matthews' coefficent 3.1 Rfactor 0.212
    Waters 13 Solvent Content 60

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch