.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x9l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A copper(I) protein possibly involved in the assembly of CuA center of bacterial cytochrome c oxidase. Proc.Natl.Acad.Sci.USA 102 3994-3999 2005
    Site SPINE
    PDB Id 1x9l Target Id CIRMMP12
    Related PDB Ids 1x7l 
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS23941,NP_295608.1 Molecular Weight 18114.27 Da.
    Residues 178 Isoelectric Point 10.40
    Sequence mtisnktltaaaaglaavlavllvpalagqsahtghtmpahtppaqtapaaqkagaqalpvtvqgatva avppsirdtaaymtltnksdqpiklvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrd gdhvmlmglkrplkvgetvnitlkatdgrtlnvaatvkkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals CU1 (COPPER) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch