The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of CaiB, a Type-III CoA Transferase in Carnitine Metabolism. Biochemistry 43 13996-14003 2004
    Site SPINE
    PDB Id 1xa3 Target Id AD59
    Molecular Characteristics
    Source E.coli
    Alias Ids TPS23834,P31572 Molecular Weight 45124.39 Da.
    Residues 405 Isoelectric Point 5.13
    Sequence mdhlpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsrrnlhal slnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahlsgfgqygteeytnlp ayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaalhkvretgkgesidiamyevmlrm gqyfmmdyfnggemcprmskgkdpyyagcglykcadgyivmelvgitqieecfkdiglahllgtpeipe gtqlihriecpygplveekldawlathtiaevkerfaelniacakvltvpelesnpqyvaresitqwqt mdgrtckgpnimpkfknnpgqiwrgmpshgmdtaailknigysendiqelvskglakved
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.17821
    Matthews' coefficent 2.60 Rfactor 0.1434
    Waters 640 Solvent Content 53.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch