.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bep

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Sumo Imodification of the Ubiquitin Conjugating Enzyme E2-25K. Nat.Struct.Mol.Biol. 12 264 2005
    Site SPINE
    PDB Id 2bep Target Id Hip2
    Molecular Characteristics
    Source Bovine
    Alias Ids TPS23917,P27924 Molecular Weight 22419.47 Da.
    Residues 200 Isoelectric Point 5.33
    Sequence maniavqrikrefkevlkseettknqikvdlvdenftelrgeiagppdtpyeggryqleikipetypfn ppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaaepddpqdavvanqykqnp emfkqtarlwahvyagapvsspeytkkienlcamgfdrnavivalsskswdvetatelllsn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.220
    Matthews' coefficent 3 Rfactor 0.167
    Waters 260 Solvent Content 58.7

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch