The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Sumo Imodification of the Ubiquitin Conjugating Enzyme E2-25K. Nat.Struct.Mol.Biol. 12 264 2005
    Site SPINE
    PDB Id 2bf8 Target Id SUMO
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23915,Q93068 Molecular Weight 11556.46 Da.
    Residues 101 Isoelectric Point 5.34
    Sequence msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegq riadnhtpkelgmeeedvievyqeqtgghstv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.279
    Matthews' coefficent 2.4 Rfactor 0.210
    Waters 83 Solvent Content 48.2

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch