.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bi0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Rv0216, a Conserved Hypothetical Protein from Mycobacterium Tuberculosis that is Essential for Bacterial Survival During Infection, Has a Double Hotdog Fold. Protein Sci. 14 1850 2005
    Site SPINE
    PDB Id 2bi0 Target Id rv0216
    Molecular Characteristics
    Source M. tuberculosis
    Alias Ids TPS23980, Molecular Weight 35655.31 Da.
    Residues 336 Isoelectric Point 6.51
    Sequence asgyggirvggpyfddlskgqvfdwapgvtlslglaaahqsivgnrlrlaldsdlcaavtgmpgplahp glvcdvaigqstlatqrvkanlfyrglrfhrfpavgdtlytrtevvglranspkpgraptglaglrmtt idrtdrlvldfyrcamlpaspdwkpgavpgddlsrigadapapaadptahwdgavfrkrvpgphfdagi agavlhstadlvsgapelarltlniaathhdwrvsgrrlvygghtiglalaqatrllpnlatvldwesc dhtapvhegdtlyselhiesaqahadggvlglrslvyavsdsasepdrqvldwrfsalqf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.9 Rfree 0.217
    Matthews' coefficent 2.2 Rfactor 0.173
    Waters 322 Solvent Content 43.2

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch