The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an Atypical Epoxide Hydrolase from Mycobacterium Tuberculosis Gives Insights Into its Function. J.Mol.Biol. 351 1048 2005
    Site SPINE
    PDB Id 2bng Target Id rv2740
    Molecular Characteristics
    Source M. tuberculosis
    Alias Ids TPS23970,Q9ZAG3 Molecular Weight 16592.07 Da.
    Residues 149 Isoelectric Point 4.82
    Sequence maeltetspetpetteairaveaflnalqnedfdtvdaalgddlvyenvgfsrirggrrtatllrrmqg rvgfevkihrigadgaavltertdaliigplrvqfwvcgvfevddgritlwrdyfdvydmfkgllrglv alvvpslkatl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.254
    Matthews' coefficent 2.3 Rfactor 0.222
    Waters 89 Solvent Content 45

    Ligand Information
    Metals CA (CALCIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch