.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bsy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Monomeric Dutpase from Epstein-Barr Virus Mimics Trimeric Dutpases. Structure 13 1299 2005
    Site SPINE
    PDB Id 2bsy Target Id P6-000-000-009
    Related PDB Ids 2bt1 
    Molecular Characteristics
    Source Human herpes virus 4
    Alias Ids TPS23863,P03195 Molecular Weight 30950.90 Da.
    Residues 278 Isoelectric Point 9.56
    Sequence meacphiryafqndklllqqasvgrltlvnkttillrpmktttvdlglyarppeghglmlwgstsrpvt shvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpqmeedkgpinhpqypgdvgldvsl pkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgilvkpcrwrrggvdvsltnfsdqtvflnk yrrfcqlvylhkhhltsfysphsdagvlgprslfrwasctfeevpslamgdsglsealegrqgrgfgssgq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.187
    Matthews' coefficent 1.86 Rfactor 0.148
    Waters 305 Solvent Content 50

    Ligand Information
    Ligands UMP (2'-DEOXYURIDINE) x 1;SO4 (SULFATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch