The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and DNA Binding of the Human Rtf1 Plus3 Domain. Structure 16 149 2008
    Site SPINE
    PDB Id 2bze Target Id BCBRA022
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23850,15929205 Molecular Weight 15239.84 Da.
    Residues 132 Isoelectric Point 9.43
    Sequence vslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvvetakvyqlggtr tnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldeinkkelsikealn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch