.
The Open Protein Structure Annotation Network
PDB Keyword
.

4lbd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conformational adaptation of agonists to the human nuclear receptor RAR gamma. Nat.Struct.Biol. 5 199-202 1998
    Site SPINE
    PDB Id 4lbd Target Id IGBMC-0078-000
    Related PDB Ids 1exa 1exx 1fcx 1fcy 1fcz 1fd0 2lbd 3lbd 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23882,P13631 Molecular Weight 50339.14 Da.
    Residues 454 Isoelectric Point 7.44
    Sequence matnkerlfaagalgpgsgypgagfpfafpgalrgsppfemlspsfrglgqpdlpkemaslsvetqsts seemvpsspsppppprvykpcfvcndkssgyhygvsscegckgffrrsiqknmvytchrdknciinkvt rnrcqycrlqkcfevgmskeavrndrnkkkkevkeegspdsyelspqleelitkvskahqetfpslcql gkyttnssadhrvqldlglwdkfselatkciikivefakrlpgftglsiadqitllkaacldilmlric trytpeqdtmtfsdgltlnrtqmhnagfgpltdlvfafagqllplemddtetgllsaiclicgdrmdle epekvdklqepllealrlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmpplire mlenpemfeddssqpgphpnassedevpggqgkgglkspa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2850000
    Matthews' coefficent 2.36 Rfactor 0.1830000
    Waters 111 Solvent Content 33.00

    Ligand Information
    Ligands 961 (3-FLUORO-4-[2-HYDROXY-2-(5,5,8,8-TETRAMETHYL-5,6,7,8,-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch