.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dmp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.6 A crystal structure of uracil phosphoribosyltransferase from Burkholderia pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3dmp Target Id BupsA.00076.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14941, UPP, BPSL1166 Molecular Weight 24073.63 Da.
    Residues 216 Isoelectric Point 6.30
    Sequence MKQDSRFPNLFILDHPLIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRNLPITTKRVETPLVEIDAPVIAGK KLAIVPVLRAGVGMSDGLLELIPSARVGHIGVYRADDHRPVEYLVRLPDLEDRIFILCDPMVATGYSAAHAIDVL KRRGVPGERLMFLALVAAPEGVQVFQDAHPDVKLYVASLDSHLDDHAYIVPGLGDAGDRLFGTKN
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.27053
    Matthews' coefficent 2.98 Rfactor 0.21882
    Waters 83 Solvent Content 58.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch