.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dms

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.65A crystal structure of isocitrate dehydrogenase from Burkholderia pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3dms Target Id BupsA.00092.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14937, ICD, BPSL0896 Molecular Weight 46143.69 Da.
    Residues 419 Isoelectric Point 5.65
    Sequence MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYGGKKKIHWMEIYAGEKA TKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVALRQELDLYVCLRPIQYFKGVPSPVREPEKTNM VIFRENSEDIYAGIEWAAESEQAKKVIKFLQEEMGVKKIRFPQTSGIGIKPVSKEGTERLVRKAIQYAIDNDRKS VTLVHKGNIMKFTEGAFRDAGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVVKDSIADAFLQQILLRPAEYDVI ATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHLGWTEAAD VIISAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENME
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.234
    Matthews' coefficent 2.14 Rfactor 0.205
    Waters 262 Solvent Content 42.45

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch