.
The Open Protein Structure Annotation Network
PDB Keyword
.

3doc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TrkA glyceraldehyde-3-phosphate dehydrogenase from Brucella melitensis. To be Published
    Site NON-SSGCID
    PDB Id 3doc Target Id BrabA.00052.a
    Molecular Characteristics
    Source Brucella melitensis
    Alias Ids TPS14938, TRKA Molecular Weight 36235.29 Da.
    Residues 335 Isoelectric Point 6.00
    Sequence MAVRVAINGFGRIGRNILRAIVESGRTDIQVVAINDLGPVETNAHLLRYDSVHGRFPKEVEVAGDTIDVGYGPIKV HAVRNPAELPWKEENVDIALECTGIFTSRDKAALHLEAGAKRVIVSAPADGADLTVVYGVNNDKLTKDHLVISNA SCTTNCLAPVAQVLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDLYRARAAALSMIPTSTGAAKAVGLVLPELKG KLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGRLKGILGYTDEKLVSHDFNHDSHSSVFHTDQTK VMDGTMVRILSWYDNEWGFSSRMSDTAVALGKLI
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.225
    Matthews' coefficent 2.28 Rfactor 0.185
    Waters 521 Solvent Content 46.00

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch