.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dpi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of NAD+ synthetase from Burkholderia Pseudomallei. To be Published
    Site NON-SSGCID
    PDB Id 3dpi Target Id BupsA.00025.a
    Molecular Characteristics
    Source Burkholderia pseudomallei
    Alias Ids TPS14942, 76819159 Molecular Weight 30880.26 Da.
    Residues 284 Isoelectric Point 6.18
    Sequence MSRPDQAARRRAIAAELHVSPTFDARDEAERRIGFVADYLRTAGLRACVLGISGGIDSSTAGRLAQLAVERLRASG YDARFVAMRLPYGAQHDEADARRALAFVRADETLTVDVKPAADAMLAALAAGGLAYLDHAQQDFVLGNIKARERM IAQYAVAGARNGVVIGTDHAAESVMGFFTKFGDGGADVLPLAGLTKRRVRALARMLGADEPLVLKTPTADLETLR PQRPDEHAYGITYEQIDDFLEGKPMDDAVAETVLRFYDATRHKRALPYTMFDWPGHPA
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.248
    Matthews' coefficent 2.16 Rfactor 0.226
    Waters 229 Solvent Content 42.98

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch