.
The Open Protein Structure Annotation Network
PDB Keyword
.

3krs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Triosephosphate Isomerase from Cryptosporidium Parvum at 1.55A Resolution. To be Published
    Site SSGCID
    PDB Id 3krs Target Id CrpaA.01119.a
    Molecular Characteristics
    Source Cryptosporidium parvum
    Alias Ids TPS31872, Molecular Weight 27382.60 Da.
    Residues 250 Isoelectric Point 5.48
    Sequence msrkyfvggnfkcngtkeslktlidsfkqvessnsevyvfptslhislvkeffgndhpgvfkigsqnisc tgngaftgevscemlkdmdvdcslvghserrqyysetdqivnnkvkkglenglkivlcigeslseretg ktndviqkqltealkdvsdlsnlviayepiwaigtgvvatpgqaqeahafireyvtrmynpqvssnlri iyggsvtpdncnelikcadidgflvggaslkptfakiiesaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.188
    Matthews' coefficent 2.56 Rfactor 0.157
    Waters 845 Solvent Content 52.00

    Ligand Information
    Ligands UNX-UNX-UNX-UNX-UNX (UNKNOWN) x 2;UNX (UNKNOWN) x 2
    Metals NA (SODIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch