.
The Open Protein Structure Annotation Network
PDB Keyword
.

3myb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of enoyl-coa hydratase mycobacterium smegmatis. To be Published
    Site SSGCID
    PDB Id 3myb Target Id MysmA.00358.j
    Molecular Characteristics
    Source Mycobacterium smegmatis atcc 700084 / mc(2)155
    Alias Ids TPS58259, Molecular Weight 28292.97 Da.
    Residues 265 Isoelectric Point 5.38
    Sequence mseplllqdrdergvvtltlnrpqafnalseamlaalgeafgtlaedesvravvlaasgkafcaghdlk emraepsreyyeklfarctdvmlaiqrlpapviarvhgiataagcqlvamcdlavatrdarfavsginv glfcstpgvalsrnvgrkaafemlvtgefvsaddakglglvnrvvapkalddeieamvskivakpraav amgkalfyrqietdiesayadagttmacnmmdpsalegvsaflekrrpewhtpqpsta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.55 Rfree 0.133
    Matthews' coefficent 2.20 Rfactor 0.114
    Waters 939 Solvent Content 44.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch