.
The Open Protein Structure Annotation Network
PDB Keyword
.

3njb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of enoyl-coa hydratase from Mycobacterium smegmatis, iodide soak. To be Published
    Site SSGCID
    PDB Id 3njb Target Id MysmA.00358.i
    Molecular Characteristics
    Source Mycobacterium smegmatis atcc 700084 / mc(2)155
    Alias Ids TPS58257, Molecular Weight 33672.33 Da.
    Residues 312 Isoelectric Point 5.65
    Sequence mthairpvdfdnlktmtyevtdrvaritfnrpekgnaivadtplelsalveradldpdvhvilvsgrge gfcagfdlsayaegsssagggspyegtvlsgktqalnhlpdepwdpmvdyqmmsrfvrgfaslmhcdkp tvvkihgycvaggtdialhadqviaaadakigyppmrvwgvpaaglwahrlgdqrakrllftgdcitga qaaewglaveapdpadldarterlveriaampvnqlimaklacntallnqgvatsqmvstvfdgiarht peghafvatarehgfreavrrrdepmgdhgrrasdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.181
    Matthews' coefficent 3.04 Rfactor 0.149
    Waters 493 Solvent Content 59.00

    Ligand Information
    Ligands
    Metals IOD (IODIDE) x 27

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch