.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nwo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Proline iminopeptidase Mycobacterium smegmatis. To be Published
    Site SSGCID
    PDB Id 3nwo Target Id MysmA.00560.a
    Molecular Characteristics
    Source Mycobacterium smegmatis atcc 700084 / mc(2)155
    Alias Ids TPS58263, Molecular Weight 33791.22 Da.
    Residues 309 Isoelectric Point 5.36
    Sequence mlsrmpvssrtvpfgdhetwvqvttpenaqphalplivlhggpgmahnyvaniaaladetgrtvihydq vgcgnsthlpdapadfwtpqlfvdefhavctalgieryhvlgqswggmlgaeiavrqpsglvslaicns pasmrlwseaagdlraqlpaetraaldrheaagtithpdylqaaaefyrrhvcrvvptpqdfadsvaqm eaeptvyhtmngpnefhvvgtlgdwsvidrlpdvtapvlviagehdeatpktwqpfvdhipdvrshvfp gtshcthlekpeefravvaqflhqhdlaadarv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.173
    Matthews' coefficent 2.10 Rfactor 0.136
    Waters 333 Solvent Content 40.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;EDO (1,2-ETHANEDIOL) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch