.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oc7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an enoyl-CoA hydratase from Mycobacterium avium. TO BE PUBLISHED
    Site SSGCID
    PDB Id 3oc7 Target Id MyavA.01530.a
    Molecular Characteristics
    Source Mycobacterium avium 104
    Alias Ids TPS58249, Molecular Weight 27343.26 Da.
    Residues 263 Isoelectric Point 5.32
    Sequence mdalvdyagpaatggpvarltlnsphnrnalstalvsqlhqglrdassdpavrvvvlahtggtfcagad lseagsggspssaydmaveraremaalmraivesrlpviaaidghvraggfglvgacdiavagprssfa ltearigvapaiisltllpklsaraaaryyltgekfdarraeeiglitmaaedldaaidqlvtdvgrgs pqglaaskalttaavlerfdrdaerlaeesarlfvsdearegmlaflekrspnwts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.1808
    Matthews' coefficent 2.26 Rfactor 0.1717
    Waters 228 Solvent Content 45.57

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch