.
The Open Protein Structure Annotation Network
PDB Keyword
.

1bvr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Mycobacterium tuberculosis enoyl-ACP reductase, InhA, in complex with NAD+ and a C16 fatty acyl substrate. J.Biol.Chem. 274 15582-15589 1999
    Site TBSGC
    PDB Id 1bvr Target Id Rv1484
    Related PDB Ids 1enz 1eny 1zid 1p44 1p45 2aq8 2b35 2b36 2b37 2h7i 2h7l 2h7m 2h7n 2h7p 2nv6 
    Molecular Characteristics
    Source
    Alias Ids TPS9459,15608622, P0A5Y6, 15608622, NP_216000.1 Molecular Weight 28526.21 Da.
    Residues 269 Isoelectric Point 5.73
    Sequence mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplleldvqnee hlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisaysyasmakallpim npggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygvrsnlvaagpirtlamsaivggal geeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiyadggahtqll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.80 Rfree 0.344
    Matthews' coefficent 2.37 Rfactor 0.217
    Waters 663 Solvent Content 53.00

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 6;THT (TRANS-2-HEXADECENOYL-(N-ACETYL-CYSTEAMINE)-THIOESTER) x 4
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch