.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dqy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat.Struct.Biol. 7 141-146 2000
    Site TBSGC
    PDB Id 1dqy Target Id Rv0129c
    Related PDB Ids 1dqz 1va5 
    Molecular Characteristics
    Source
    Alias Ids TPS9424,57116693, P0A4V4, 57116693, YP_177694.1 Molecular Weight 36769.33 Da.
    Residues 340 Isoelectric Point 5.92
    Sequence mtffeqvrrlrsaattlprrlaiaamgavlvyglvgtfggpatagafsrpglpveylqvpsasmgrdik vqfqgggphavylldglraqddyngwdintpafeeyyqsglsvimpvggqssfytdwyqpsqsngqnyt ykwetfltrempawlqankgvsptgnaavglsmsggsalilaayypqqfpyaaslsgflnpsegwwptl iglamndsggynansmwgpssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegl tlrtnqtfrdtyaadggrngvfnfppngthswpywneqlvamkadiqhvlngatppaapaapaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.83 Rfree 0.1887
    Matthews' coefficent 2.71 Rfactor 0.1684
    Waters 292 Solvent Content 54.63

    Ligand Information
    Ligands DEP (DIETHYL) x 1;MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 2
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch