.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eyv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of NusB from Mycobacterium tuberculosis. Nat.Struct.Biol. 7 475-478 2000
    Site TBSGC
    PDB Id 1eyv Target Id Rv2533c
    Molecular Characteristics
    Source
    Alias Ids TPS20690,15609670, P95020, 15609670, NP_217049.1 Molecular Weight 16739.23 Da.
    Residues 156 Isoelectric Point 6.59
    Sequence msdrkpvrgrhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavargvsehaahi ddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlakelstddspgfvngvlgqv mlvtpqlraaaqavrgga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.234
    Matthews' coefficent 1.98 Rfactor 0.19
    Waters 291 Solvent Content 37.75

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch