.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of isocitrate lyase, a persistence factor of Mycobacterium tuberculosis. Nat.Struct.Biol. 7 663-668 2000
    Site TBSGC
    PDB Id 1f61 Target Id Rv0467
    Related PDB Ids 1f8m 1f8i 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS27482,57116734, P0A5H3, 57116734, YP_177728.1 Molecular Weight 47084.12 Da.
    Residues 428 Isoelectric Point 5.03
    Sequence msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweqlhdlewvnal galtgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqvvrrinnalqradqiakie gdtsvenwlapivadgeagfggalnvyelqkaliaagvagshwedqlasekkcghlggkvliptqqhir tltsarlaadvadvptvviartdaeaatlitsdvderdqpfitgertregfyrtkngiepciarakaya pfadliwmetgtpdleaarqfseavkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqf itlagfhalnysmfdlaygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnss ttaltgsteegqfh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.191
    Matthews' coefficent 3.74 Rfactor 0.165
    Waters 692 Solvent Content 67.10

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch