The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Mycobacterium tuberculosis nucleoside diphosphate kinase. Proteins 47 556-557 2002
    Site TBSGC
    PDB Id 1k44 Target Id Rv2445c
    Molecular Characteristics
    Alias Ids TPS27507,15609582, P84284, 15609582, P71904, NP_216961.1 Molecular Weight 14506.70 Da.
    Residues 136 Isoelectric Point 5.34
    Sequence mtertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgsllefitsg pvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaesaqreialwfpga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.60 Rfree 0.2460000
    Matthews' coefficent 2.78 Rfactor 0.2050000
    Waters 107 Solvent Content 55.82

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch