The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis. J.Biol.Chem. 277 11559-11569 2002
    Site TBSGC
    PDB Id 1kph Target Id Rv3392c
    Related PDB Ids 1kp9 1kpg 
    Molecular Characteristics
    Alias Ids TPS20719,15610528, Q11195, 15610528, Q11195, NP_217909.1 Molecular Weight 32459.55 Da.
    Residues 287 Isoelectric Point 5.80
    Sequence mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqpgmtll dvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagweqfdepvdrivsiga fehfgherydaffslahrllpadgvmllhtitglhpkeiherglpmsftfarflkfivteifpggrlps ipmvqecasangftvtrvqslqphyaktldlwsaalqankgqaialqseevyerymkyltgcaemfrig yidvnqftcqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.24
    Matthews' coefficent 2.03 Rfactor 0.194
    Waters 732 Solvent Content 39.30

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch