.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kpi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis. J.Biol.Chem. 277 11559-11569 2002
    Site TBSGC
    PDB Id 1kpi Target Id Rv0503c
    Molecular Characteristics
    Source
    Alias Ids TPS9437,15607644, P0A5P0, 15607644, NP_215017.1 Molecular Weight 34658.29 Da.
    Residues 302 Isoelectric Point 5.11
    Sequence mtsqgdttsgtqlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyakrklaldkln lepgmtlldigcgwgstmrhavaeydvnvigltlsenqyahdkamfdevdsprrkevriqgweefdepv drivslgafehfadgagdagferydtffkkfynltpddgrmllhtitipdkeeaqelgltspmsllrfi kfilteifpggrlprisqvdyyssnagwkveryhriganyvptlnawadalqahkdeaialkgqetydi ymhylrgcsdlfrdkytdvcqftlvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.65 Rfree 0.242
    Matthews' coefficent 4.67 Rfactor 0.208
    Waters 62 Solvent Content 73.68

    Ligand Information
    Ligands CO3 (CARBONATE) x 1;SO4 (SULFATE) x 4;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1;10A (DIDECYL-DIMETHYL-AMMONIUM) x 1
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch