The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis. J.Biol.Chem. 277 11559-11569 2002
    Site TBSGC
    PDB Id 1l1e Target Id Rv0470c
    Molecular Characteristics
    Alias Ids TPS9436,57116736, Q7D9R5, 57116736, YP_177730.1 Molecular Weight 33026.07 Da.
    Residues 287 Isoelectric Point 6.00
    Sequence msvqltphfgnvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklnlepgmtll digcgwgatmrraiekydvnvvgltlsenqaghvqkmfdqmdtprsrrvllegwekfdepvdrivsiga fehfghqryhhffevthrtlpadgkmllhtivrptfkegrekgltlthelvhftkfilaeifpggwlps iptvheyaekvgfrvtavqslqlhyartldmwataleankdqaiaiqsqtvydrymkyltgcaklfrqg ytdvdqftlek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.27
    Matthews' coefficent 2.00 Rfactor 0.222
    Waters 200 Solvent Content 38.53

    Ligand Information



    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch