The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a major secreted protein of Mycobacterium tuberculosis-MPT63 at 1.5-A resolution. 2002
    Site SGC
    PDB Id 1lmi Target Id Rv1926c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20662,15609063, P0A5Q2, NP_216442.1 Molecular Weight 16513.11 Da.
    Residues 159 Isoelectric Point 4.92
    Sequence mklttmiktavavvamaaiatfaapvalaaypitgklgseltmtdtvgqvvlgwkvsdlksstavipgyp vagqvweatatvnairgsvtpavsqfnartadginyrvlwqaagpdtisgatipqgeqstgkiyfdvtg psptivamnngmedlliwep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2524
    Matthews' coefficent 1.65 Rfactor 0.197
    Waters 172 Solvent Content 25.60

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch