.
The Open Protein Structure Annotation Network
PDB Keyword
.

1n3i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Over-The-Barrier Transition State Analogues Provide New Chemistries for Inhibitor Design: The Case of Purine Nucleoside Phosphorylase. BIOCHEMISTRY 42 6057-6066 2003
    Site TBSGC
    PDB Id 1n3i Target Id Rv3307
    Related PDB Ids 1g2o 1i80 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS27512,15610443, P0A538, 15610443, O53359, NP_217824.1 Molecular Weight 27569.88 Da.
    Residues 268 Isoelectric Point 5.51
    Sequence madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaagha gellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglradlqvgqpvlisd hlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgphyetpaeirmlqtlgadlvgm stvhetiaaraagaevlgvslvtnlaagitgeplshaevlaagaasatrmgalladviarf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.213
    Matthews' coefficent 2.37 Rfactor 0.183
    Waters 432 Solvent Content 48.15

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3;DIH (3-HYDROXY-4-HYDROXYMETHYL-1-(4-OXO-4,4A,5,7A-) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch