.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nwa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Mycobacterium tuberculosis Methionine Sulfoxide Reductase A in Complex with Protein-bound Methionine. J.Bacteriol. 185 4119-4126 2003
    Site TBSGC
    PDB Id 1nwa Target Id Rv0137c
    Molecular Characteristics
    Source
    Alias Ids TPS20595,15607279, P0A5L0, 15607279, NP_214651.1 Molecular Weight 20483.70 Da.
    Residues 182 Isoelectric Point 5.71
    Sequence mtsnqkailaggcfwglqdlirnqpgvvstrvgysggnipnatyrnhgthaeaveiifdptvtdyrtll efffqihdpttkdrqgndrgtsyrsaifyfdeqqkrialdtiadveasglwpgkvvtevspagdfweae pehqdylqrypngytchfvrpgwrlprrtaesalraslspelgt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.177
    Matthews' coefficent 2.12 Rfactor 0.16
    Waters 231 Solvent Content 41.52

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch