.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Catalytic Domain of the Pknb Serine/Threonine Kinase from Mycobacterium Tuberculosis. J.Biol.Chem. 278 13094-13100 2003
    Site TBSGC
    PDB Id 1o6y Target Id Rv0014c
    Related PDB Ids 1mru 
    Molecular Characteristics
    Source
    Alias Ids TPS9416,15607156, P0A5S4, 15607156, NP_214528.1 Molecular Weight 66506.14 Da.
    Residues 626 Isoelectric Point 5.22
    Sequence mttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqnaaalnhp aivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadacqalnfshqngiihrd vkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqylspeqargdsvdarsdvyslgcvly evltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenryqtaaemradlvrv hngeppeapkvltdaertsllssaagnlsgprtdplprqdlddtdrdrsigsvgrwvavvavlavltvv vtiaintfggitrdvqvpdvrgqssadaiatlqnrgfkirtlqkpdstippdhvigtdpaantsvsagd eitvnvstgpeqreipdvstltyaeavkkltaagfgrfkqanspstpelvgkvigtnppanqtsaitnv viiivgsgpatkdipdvagqtvdvaqknlnvygftkfsqasvdsprpagevtgtnppagttvpvdsvie lqvskgnqfvmpdlsgmfwvdaeprlralgwtgmldkgadvdaggsqhnrvvyqnppagtgvnrdgiitlrfgq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.2303
    Matthews' coefficent 2.22 Rfactor 0.1909
    Waters 85 Solvent Content 44.17

    Ligand Information
    Ligands ACP (PHOSPHOMETHYLPHOSPHONIC) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch