.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p44

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Targeting tuberculosis and malaria through inhibition of Enoyl reductase: compound activity and structural data. J.Biol.Chem. 278 20851-20859 2003
    Site TBSGC
    PDB Id 1p44 Target Id Rv1484
    Related PDB Ids 1enz 1eny 1bvr 1zid 1p45 2aq8 2b35 2b36 2b37 2h7i 2h7l 2h7m 2h7n 2h7p 2nv6 
    Molecular Characteristics
    Source
    Alias Ids TPS9461,15608622, P0A5Y6, 15608622, NP_216000.1 Molecular Weight 28526.21 Da.
    Residues 269 Isoelectric Point 5.73
    Sequence mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplleldvqnee hlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisaysyasmakallpim npggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygvrsnlvaagpirtlamsaivggal geeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiyadggahtqll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.288
    Matthews' coefficent 2.35 Rfactor 0.19
    Waters 147 Solvent Content 47.61

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 6;GEQ (5-{[4-(9H-FLUOREN-9-YL)PIPERAZIN-1-YL]CARBONYL}-1H-) x 4
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch