.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q74

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of 1-D-myo-Inosityl 2-Acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB) from Mycobacterium tuberculosis Reveals a Zinc Hydrolase with a Lactate Dehydrogenase Fold. J.Biol.Chem. 278 47166-47170 2003
    Site TBSGC
    PDB Id 1q74 Target Id Rv1170
    Related PDB Ids 1q7t 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS9451,15608310, O50426, 15608310, NP_215686.1 Molecular Weight 31740.51 Da.
    Residues 303 Isoelectric Point 5.18
    Sequence msetprllfvhahpddeslsngatiahytsrgaqvhvvtctlgeegevigdrwaqltadhadqlggyri geltaalralgvsapiylggagrwrdsgmagtdqrsqrrfvdadprqtvgalvaiirelrphvvvtydp nggyghpdhvhthtvttaavaaagvgsgtadhpgdpwtvpkfywtvlglsalisgaralvpddlrpewv lpradeiafgysddgidavveadeqaraakvaalaahatqvvvgptgraaalsnnlalpiladehyvla ggsagardergwetdllaglgftasgt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.22787
    Matthews' coefficent 2.57 Rfactor 0.1944
    Waters 760 Solvent Content 52.16

    Ligand Information
    Ligands PE4 (2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-) x 1
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch