The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of MshB from Mycobacterium tuberculosis, a Deacetylase Involved in Mycothiol Biosynthesis. J.Mol.Biol. 335 1131-1141 2004
    Site TBSGC
    PDB Id 1q7t Target Id Rv1170
    Related PDB Ids 1q74 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS9452,15608310, O50426, 15608310, NP_215686.1 Molecular Weight 31740.51 Da.
    Residues 303 Isoelectric Point 5.18
    Sequence msetprllfvhahpddeslsngatiahytsrgaqvhvvtctlgeegevigdrwaqltadhadqlggyri geltaalralgvsapiylggagrwrdsgmagtdqrsqrrfvdadprqtvgalvaiirelrphvvvtydp nggyghpdhvhthtvttaavaaagvgsgtadhpgdpwtvpkfywtvlglsalisgaralvpddlrpewv lpradeiafgysddgidavveadeqaraakvaalaahatqvvvgptgraaalsnnlalpiladehyvla ggsagardergwetdllaglgftasgt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.215
    Matthews' coefficent 2.06 Rfactor 0.19
    Waters 326 Solvent Content 40.20

    Ligand Information
    Ligands BOG (B-OCTYLGLUCOSIDE) x 3;SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch