.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qpr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of quinolinic acid phosphoribosyltransferase from Mycobacterium tuberculosis: a potential TB drug target. Structure 6 1587-1599 1998
    Site TBSGC
    PDB Id 1qpr Target Id Rv1596
    Related PDB Ids 1qpn 1qpo 1qpq 
    Molecular Characteristics
    Source
    Alias Ids TPS9466,15608734, O06594, 15608734, O06594, NP_216112.1 Molecular Weight 29949.37 Da.
    Residues 285 Isoelectric Point 5.09
    Sequence mglsdwelaaaraaiargldedlrygpdvttlatvpasatttaslvtreagvvagldvalltlnevlgt ngyrvldrvedgarvppgealmtleaqtrglltaertmlnlvghlsgiatataawvdavrgtkakirdt rktlpglralqkyavrtgggvnhrlglgdaalikdnhvaaagsvvdalravrnaapdlpcevevdsleq ldavlpekpelilldnfavwqtqtavqrrdsraptvmlessgglslqtaatyaetgvdylavgalthsv rvldigldm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.45 Rfree 0.2510000
    Matthews' coefficent 2.37 Rfactor 0.1860000
    Waters 339 Solvent Content 48.10

    Ligand Information
    Ligands PHT (PHTHALIC) x 6;PPC (5-PHOSPHORIBOSYL-1-(BETA-METHYLENE)) x 6
    Metals MN (MANGANESE) x 12

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch