.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s8n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis. Structure 12 1595-1605 2004
    Site TBSGC - European Molecular Biology Laboratory, Hamburg
    PDB Id 1s8n Target Id Rv1626
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS9467, RV1626 Molecular Weight 22352.44 Da.
    Residues 202 Isoelectric Point 5.02
    Sequence tgpttdadaavprrvliaedealirmdlaemlreegyeivgeagdgqeavelaelhkpdlvimdvkmprrdgidaa seiskriapivvltafsqrdlverardagamaylvkpfsisdlipaielavsrfreitalegevatlserletrk lverakglqtkhgmtepdafkwiqraamdrrttmkrvaevvletlgtpkdt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.48 Rfree 0.22835
    Matthews' coefficent 2.00 Rfactor 0.2029
    Waters 201 Solvent Content 38.48

    Ligand Information
    Ligands AZI (AZIDE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch