.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sjp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the 65-Kilodalton Heat Shock Protein, Chaperonin 60.2, of Mycobacterium tuberculosis. J.Bacteriol. 186 8105-8113 2004
    Site TBSGC
    PDB Id 1sjp Target Id Rv0440
    Molecular Characteristics
    Source
    Alias Ids TPS9433,15607581, P0A520, NP_214954.1 Molecular Weight 56723.50 Da.
    Residues 540 Isoelectric Point 4.85
    Sequence maktiaydeearrglerglnaladavkvtlgpkgrnvvlekkwgaptitndgvsiakeieledpyekig aelvkevakktddvagdgtttatvlaqalvreglrnvaaganplglkrgiekavekvtetllkgakeve tkeqiaataaisagdqsigdliaeamdkvgnegvitveesntfglqleltegmrfdkgyisgyfvtdpe rqeavledpyillvsskvstvkdllpllekvigagkplliiaedvegealstlvvnkirgtfksvavka pgfgdrrkamlqdmailtggqviseevgltlenadlsllgkarkvvvtkdettivegagdtdaiagrva qirqeiensdsdydreklqerlaklaggvavikagaatevelkerkhriedavrnakaaveegivaggg vtllqaaptldelklegdeatganivkvaleaplkqiafnsglepgvvaekvrnlpaghglnaqtgvye dllaagvadpvkvtrsalqnaasiaglfltteavvadkpekekasvpgggdmggmdf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.20 Rfree 0.2849
    Matthews' coefficent 2.87 Rfactor 0.24142
    Waters Solvent Content 56.77

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch