.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ue5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Mycobacterium tuberculosis single-stranded DNA-binding protein. Variability in quaternary structure and its implications. J.MOL.BIOL. 331 385-393 2003
    Site TBSGC
    PDB Id 1ue5 Target Id Rv0054
    Related PDB Ids 1ue1 1ue6 1ue7 
    Molecular Characteristics
    Source
    Alias Ids TPS9421,15607196, P0A610, 15607196, NP_214568.1 Molecular Weight 17352.11 Da.
    Residues 164 Isoelectric Point 5.12
    Sequence magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwreaaenvae sltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasrsggfgsgsrpapaqts sasgddpwgsapasgsfgggddeppf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.275
    Matthews' coefficent 2.73 Rfactor 0.212
    Waters 214 Solvent Content 54.66

    Ligand Information
    Ligands
    Metals CD (CADMIUM) x 2

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch